PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF046300070CFD_t1
Common NameTRAES_3BF046300070CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family VOZ
Protein Properties Length: 550aa    MW: 61659.5 Da    PI: 5.1925
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF046300070CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ420.43e-1292554721217
                      VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaat 85 
                              p+p++fl+pkcalwdc+rpaqgse++qdycs++ha+la++e g+pgt+pv+rp+gidlkdg+lfaalsak+qgk+vg+p+cegaat
  TRAES3BF046300070CFD_t1 255 PAPASFLRPKCALWDCPRPAQGSERWQDYCSMYHAELAVKEeGPPGTMPVIRPRGIDLKDGPLFAALSAKIQGKHVGVPVCEGAAT 340
                              89*************************************9879******************************************* PP

                      VOZ  86 akspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlye 171
                              +kspwna+elfdl ++ege++rewlffdkprraf+sgnrkqrslpdy+grgwhesrkqvmk+fgglkrsyymdpqpsss+ewhlye
  TRAES3BF046300070CFD_t1 341 TKSPWNAPELFDLYIFEGESMREWLFFDKPRRAFDSGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKRSYYMDPQPSSSYEWHLYE 426
                              ************************************************************************************** PP

                      VOZ 172 yeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                              yein+ da+alyrle+k++++kksak+k ++++l ++q++++rl+a
  TRAES3BF046300070CFD_t1 427 YEINDRDAFALYRLEFKSSEAKKSAKSKFTCSPLIEIQQQMVRLSA 472
                              ********************************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MRKGPSRSGS ARHQQFRARA KTRVDDLQDM FSGLQYARKE ARSTDAVLLE AQLHQMLREW  60
RAELSVPSPA SSLQENNNRD PSDPPSETPR PPQLAPAEEE DDATSKLVEQ KPRPSANQAH  120
KHAQGDHDMK PEPHEEAIAD PVTVAQQPTS LGPGVVATGG EVLTPATAVF HDQMYYVNQE  180
LSVEDFLYDD DYKINLPGSN PEILNNLEGI GHQEYLQFNL PQELPPNAYL DMNNYGQNAG  240
DGFLHMSDLL TTMSPAPASF LRPKCALWDC PRPAQGSERW QDYCSMYHAE LAVKEEGPPG  300
TMPVIRPRGI DLKDGPLFAA LSAKIQGKHV GVPVCEGAAT TKSPWNAPEL FDLYIFEGES  360
MREWLFFDKP RRAFDSGNRK QRSLPDYNGR GWHESRKQVM KDFGGLKRSY YMDPQPSSSY  420
EWHLYEYEIN DRDAFALYRL EFKSSEAKKS AKSKFTCSPL IEIQQQMVRL SADGPVENKR  480
TARARTQDVS TNVYPVQNNT AQANAPDAYQ AASQADQMTF LNGSVVYGPH LPYGYSTEGG  540
DFYWNSNDGA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631850.0AK363185.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013F10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569827.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-151VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A077RUV70.0A0A077RUV7_WHEAT; Uncharacterized protein
STRINGMLOC_75554.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-142vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]